ELF 404 (444GG`lWW /lib/ld-linux.so.2GNU%0 !'.%*"( ,/ &-)  $#+gk<`X}"̉8܉*9_#6 f,p<%L\l"(dXhX.|7AR7̊@܊lXq K/!,/X<;L \l||SGj+R/pXl̋L܋[$ *w   __gmon_start__libc.so.6strcpyprintfstdout__ctype_bgetenv__strtol_internalfgetsmemcpypcloseputsfeofmallocreaddir__ctype_toupperstrncasecmppopenstrrchrfprintfstrcat__deregister_frame_infochdirstrstrstrncmpstrncpyreallocfreadtimeopendirstrcmpsprintffclosestderrstrftime__xstat__errno_locationexitfopen_IO_putc_IO_stdin_usedgmtime__libc_start_mainstrchrfputsclosedir__ctype_tolower__register_frame_infoGLIBC_2.1GLIBC_2.0ii ii W.`XdXhXlXpX'W W$W(W,W0W4W8W GPGСG8ult hVGÐUUthtXhVÐUÐUWUװM QRu$h5hXjc&}ÍvUE@Puh5hXwjÉUWS]߰эAPǃSWde[_ÍvU WVSu} эYEPE PV;E~E0e[^_ÐU WVSuэY;]}7} эA;U~})߃WE P3P~0e[^_ÐUVSuE]9~ÃSu V03e[^ÍvUWVS]1߰эM=v"Sh5hX jt&E߰эA9sPEXEB<vB<vB< vU\FUUFE߰эA9ErƆXXe[^_UWVSUu ӉэDY=wWhR,ShhNS; hVPShPS?Vh 5hX1[^_ÍvUuÐUVShPh`ƃu28t(h`h5hXljhuh{jt&,5dXSVhSu؃Vu"h`h 5hXjzV1jgvUSƅjIPD PhhSS5IÍvUM\u1lBRB^9 tR uȅ}\)щʈ\\<CCSDGt"K0t)t/DGt{)tXt) Knt ls;uv#{>uN;ut>>tGFEUXu{)u})uEɉMN;uvFGuF<_t<:t<-t<.t݊U5dX}W EUU}}t$VU`X4EPVh`A VURVh,EUU5dX}W(CEU؋ߋ pXGtAu_t-t+t.t܀.uO)؃~YE5dXUR+E߈USSuPhrE߈} C5dXUR{}C.]ߋpX;]v6CBuCO;}v!GBuG<_t<-t<+t<.t<%tٍs pXStAAu_t-t +t.u*FtAu_t-t+t.t܀.uN)؃~6)~-5dXEPWWh5dXUR@}}];]v+CpXO;}vGB%f=ts])}Ft#ѡpXDP ut "t&u֋EԃwG)؃~>5dXEP3WWh u (&C5dXURC/C]1ۋEt;Esh E@PEEt;Esj@E@PEEt;Esh }WEEt;EshEPtEEt;Esj(E@P#EEt;EshE@P/E1҅M؃<Bt5dXURe[^_ÉUVS]=RtF1R;t'=RuD< u RB<uك=RuD=Qtm;t&Q9Q|-P5QQQQ QQ CQ;ua&=RtQ;tL\R2R; t =R'~R0VRC;ue[^ÍvUEBtX0t; Z|VV4O,PtB It4Lt4Rt/=WCt&1t& 1R}H)£RRU WVS]Rt,|9 0|Rà ~ }9u REjPV =RthVRtLhVэA~ 0+ t&0-ۀ01D"D>DEPjPhWe[^_ÉUWVS]1= Ssx$rbtC< uKGt&R4C<!C<\uCP^KEE뢐C;(u떐t&CS4CVvC;(uCS4C p V'Zt&C<\uCSK5 S <(t 3&CS4C=$SVǃ3CE1<-uE&<+uEC<0uCb<\u'CSAË5 S}uWENvpXDQt&tBCDAtt}u~܃}uEt=$SuuVǃNt&?CE<+t<-tE vEC;(uCS4C p \R t#92utEBBB St&f.ts.u R SbR SR SBC3CRE$SER$SE EQ8uCPÃC9uًERE$SE SRC3CRE$SER$S!Q8uCPÃt&C9u؋ERE$SvRR6t&R$HRRY&R%R9&%=(StKt&EE}RC=$Su WS؍e[^_ÐUUzt+t&Rzut&Rt&@,uuÍvUWVS]U t Pj 1EE@MAj0EU}@S <.&r$Ext%j0UB,EǾ@S lXUBmlXMAPClXUBCpXDP +%MA tC11;+uC;-uC pXDQtt&DBCDQutƋUBMAE(PCP" ÃExt@UB ~&1 pXDQtDBCDQuMA$Lt&j RUBPJMAj02UEǾ@S C CЄt .';.u C< uEUUt?M M1M}t@MI,Mu9~UMIMuNjUE ؍e[^_ÐU WVSUBt!ExPj RMAHEQUBtj0&ËMA1ۋE8t&ߋu E@,Etj0C,[,9]uȋEe[^_ÐUlWVSEEEEEEE EUBU< u׀:.u H RMċR]5Ruj,P jP =RuRhUMM]]vGt< u;Pwu9};UpXpSSDB tE]DB uE=pSt.ˋE40UR4!t E@E<uԋE4u$|EEEt&Ez&Ej&MAM<(u]AMKpXuFu<(uDBt,EMDBu&];)t Eu>)uE9}EEURMQ]SEuuVEEE }E_t=*MA:Et< ]{ < u~t/j ‹FPF@pVBPF@F j EUB@BPj0‹MAU׸@S UMAEA]]U"]}t%uUBMI,MuFtySt< uEPEU]TMy{σhWoEE]E]SjWBSjhSrBuTu }tEUMI,MtySt]{ uVEE&. MA.u*~ u$VpXDPuUBU< u}EMt:Euy\u < u]{\tEEU8u E ?\u< u6G<w-W}t GMAv][,]t{StLE]SjWg@ǃSjhSU@ }tEuE@,EtxSt}tUM} ]SE0uEExtt&URUzu}ty11ɋuFtXT&BSt^tt/AB9A}$AtCuI,t ExStR,t[,uURUu}th'}uhh}u}t$EEt&E)Et&EEt&EEʍ&UEљ뮋UEљUE9EAt&E9Et&E9E!t&E9EMhE9EƒUU1}1}% 1}u }EPh5hXE tѡpXDP u )3)uCUE ؍e[^_ÍvUSE E]U1ɀ: t*u:Qu :Eu1B: uڅu[ÐU WVS} ]E1u3 uL"u un:Qu_ tH uUH}uL 9tB 8v8"u+H 9tB@ @t uH1HȊt ju;tB[^_ÍvU WVSu1uB=St,S3V.t ;u uF>3~ uDžDž @0< t< tQ8u~$2FP2VЉPPdE$RB4R%.ND%l.A%^.B%..J%q..N%.*.rA*0V%.T%2..dA!+|. B B].IBiL.dC,_kB! dB"eB8$.vtB!lB-xB!-lD!2TDmC',-dD -tDqD&-vDd,o-tIPH`mE)!kE lE$-t&lF$vE+-rF+,PIs2 I5 I',BI,XIXRI,cI*,sNc+bsM*#PLiL;+F,mN)dNF)!,oN+,pO%2cO%PO+oOj%+sOrO%*+DP.+saSSER^pP#aPs#fPg#B+lQ&qP%!+BR,+sR2SRIR *eRT*HS{BS*MS*STbsS#hSqS &f*HTyS(A*PTd/*cX&2nT)XT[*aV&)barX )mae)fieisd[ccrb2cn)edecO)id>)xe1le$ce)oe(ifcf(tfT(spbNn'#gi)ni+(rnhfn}q(xn+_(ps%)mrE(nrYosC((it at> (=mt> 'Gt< u=Qt$QtQ5QSjVЉ< uF*Ft< uF>t-jh$Vtt F< u>u\t9t R t9uu:j‹B\B B\t&BBBPjWG*.*F< u)RVЉDžv@0t< u苅 )~ u F &pX \DB t&FDB u>"uF˅t9t [ t9u(SRudj~ËC\C C\Dž,,PjV)Ƌ,CRC Tt4Dž((PjV(C(Ct&CPjV(ƃRC(SRJ(=PRth$h;RQ8'FP9< t Q'Q''< t Q'Q.'> uDž4t&Džt&DBЉF< vVƃG'h$Qjt&Dž$$PjVH'ƃ$t;jhKPt$$h t>uhfR&< t Q&Q\&Qe&j"< uQQ4&QFQ!&=Rut(t&SVt F< u>u݊T$F< uJ$=RC&> u j0DžDž<-uDž<+u DžFPVƃuDž~ P|P q#=Rth%zhJkJ R-#1ۉR>/t~F.F.F/> tF> uPjW#ǀ/uQWjjtDCP W uDWh %5hX茾h`% Wh%r 't& DDjj@Pe" F&"t&Dž> ta`R`RPV<-t<+u TF< t< t> uRR!hPVEDž ~.t&h[P;|׋R !&> t t&F> u P5P jj"VC> uFjjV ƃjRP0hJ=Re t&BFIjRPi h%YRfF> uFPpSVFDžt&thNR@ PP jj4H;vjRP[ th%GRhJ1=Ret&Dž1ɻ`R1ҍBу~RPpPVcFQR<uh%Qh%vtjjpth$HRQR<uh%Qh%V0ƃ >uPR jjVƃh$ PpPV>FDžJ=JZuڸt&AH<Zth%?S6 h%&QR<th$Q=Rjh%lQR<uh%Qh%PR|PpPP Dž~Pp|DQPQRh%V=R Q~0<Rth%h$ QVR{j`P jBPl jjVrƃjRPA0Et&> uFjP jj"VijjVƃ j0P t&lV1t =lVtlV> u=F:h$QR< t  ~HQ=Qu=RujPC j P- =RuRh jj"VZVW< h%h\V t h%h&jh#&V覶 hV=lVtjjVu! jjVƅt h,&h3&J)VlV=RPpSVDž9}"ڋ@H;|Rh@&p h&xh&k h&[h&N h '>p0 h' ~tP h,'t ~(h/'jjx t&h>'h@'{ 5dXh`'3 h'O=lVth'6FpV^ƃ]PpPVjIP0~ t@p;Ɖ RI RV jRP{ ~ta F6t&VЉpXFDB t> uVЉFt< uF\t9t R t9ut\9tvR 9uzmVЉ\[ t9uu3j蜱ËCC\C \SF< t< tRVƊ C F t tPVƃDžPpPVCVЉDžu Džt'tHt@.DžF>t/tV!tVMƃ>uы\t9t&[ t9utt{I2+EPǃhDž1;}#C:H;|ދt| tR8 F\u#x\u8\t&89u8t{jË\C {\j VQQR<tBQ th)PVS۲h'S6tQ8h'Eh'StQ8h'Q8h%=R`h%˿bQRth$#t h'th'vQ~HQ=Rh%Cjh'V&uVpXDP tVBƃQRh%ھjB PǾ0> uFjjV&jjVƃjRſP胾 hJsh$f 3t/h'PjjV?ƃ hJ1=Ret&jj"Vk> uFjjVƃhJ =Rvjj"Vh'訽 =Rkjj"V> uFh (jjjVYƃ =RhJ3h(& jLRP > uFjjVƃjR'P0h(ռ=R j Vi(th)PVS hJ胼\h*(SLt \h9(MhG(S uhP(S  =RtC \j;P j0P h$ӻRR \tE=Ru uFpXDS t> tFDB t> upXCt#A$9sFCt A9rpXDS t> tڐt&FDB t> uDCtG(A$9s9Ct"A9s'pXFCt A9r9s )AvF tӡpXDP uA$9r jjWhJ =R jj"V%h貹 > t;jBٺP藹 jjVƃjR贺Pr0hJb=R% t&jj"V> uFjjVƃhJ =R Dv=Rsh%޸ujj"V+> uFhC诸jjVƃ h@萸hJ胸 =RF jj"V> uFjR{P9 h%)jjVƃ jRFP hZ(hJ =R jj"V%> uFjRP裷 h%蓷jjVƃ =RG &jj"VjjVDƃ jRrP0 hZ( =RTvjj"V[> uFh\(߶jjVƃ h>'hJ賶 =Rvjj"V> uF:t\ pXDA tB:tDDA u:t5DC uB:t(DC t:tBDCt BDCu h jjVƃ h^(hJ޵ =Rjj"V> uFh蟵jjVƃ h^(耵hJs =R6jI臶PE jj"V> uh`(jjVƃjR5P hJ=RjIP赴 jj"V> uFjjVƃjR趵Pt0hJd=R'&jj"V> uFhi(jjVƃ hJ=R4vjj"V;=hVtC=VthK賳"j VZtjd)PVhVVjB赴Ps F< t< t> uhVKjjV7 ƃjReP# hJ=RGjB'P jj"V5> uFjjV ƃjRP褲0hJ蔲=RW&jj"V> uFjB苳PI jjV5 ƃjRfP$0hJ=RH&> uFjjVƃ=RjIP诱 > uFjjVƃjRƲP脱0=RG&\a9tI >9u僽-PpSVFDž;}%ڍv@H;|Dž~vDž=lVtWj4j t&Wj4mP;|Hȃ~㋅xэyDžBT8t.HȋQ D uءRRR=lVtjjzGPS jjyGPXRRDž1ҋ9}B9| =lVpX Bt FDBuFDBjVS胞C CS苮jj"V > uFjR螯P\ jjVhƃhJ= =RvRV\ƃ=RthJRJ [^_ÍvUWVSDžDžQQQRQR}t]U:t!=QэAQQ)h蔞QQQQ}V:QuDGt&PDžW迯ǃ :Qu tR=Vt6t2pXDBt"tGDBtt GDB uQ8ub Gt&PEDžWǃ} ` VOP uj=PRtapXPtSt&PѫDžh$跫RPRB5$p(&BaBmBpB;%&&BlBtB;&BgBtB;&BqBuBoBtB; u$=RtB=Vt)=Rt BVRDž BLt&1Vt"PRPRRw9`R9`RC99~;R=Ruz`R9R @=~tSxDžRPR;`R|Qh|;`R9R}(hRPR;`R|؃hJ  t t&P覨Džu#=RthKzRRthQCƄ* B(B<^w(t&&B#Bff 0BfэfЍ(fэЍf0BfэЍf(0 @;@Rw~/t&PϦDžt} =R< tPyQt Q} t?tGR}t8QUQQQQ[^_U WVSM}ˋ5VV &Ct< uA9vACpXBt1CDB t&{ t C WE PQŠCCC WE PQ‰5VЍe[^_ÐU WVSuDž(Dž$hV4SэA=vVh`)5hXj藔щ Ƅ 3. 5Dž0 I= I,h04QWуD manY,D 1J0B8!J, +4P萓ǃV @P4QZ S蚓uk$tj$B jV$0$(S$CC W_ƒ]W蹒J<0 I0<T([^_ÍvU\WVSuDžDž} tJDžJt5] 8t Èѐt&t8u鋕<uVэAdvVh)5hX1jבjdVSD .U Dž I= I:,vh4V}уDmanU DDVǃCRSX Suotj肏B jmVSqCC Wݐ\W9 I<[^_ÉUlWVSu= I IEEщMы}D=vVh)5hXj蹏hRhΑhVh EPhjmt ;\1e[^_ÉUWVSDžDžhPh*rQ+t&1ҊB < t< tӃcjSh,*usj/S賌t_ ICt&@t t t u1Ҁ8t…t/BQ1>f ];.uX߰шD SJt&@t t u1Ҁ8t…t QhPʌt ItJ IuB=$It^$IװэAP5 IR艌t F;u̓< Ith'5 I<t&5 Ih`*5hX,$I IR而[^_ÐUWVSDž Džh*(t 8Dž$E9$$M 91-t Dt&ln)$@yM*Dž ;E$U <уAPs IƋ$M <dv?%uZGpXDPtЈ `X©GpXDXt v`XFGu@~/t\/FSyt(yu4ApXBt!DBut V$@v$@9t($U9q((ʉװэAP@(Ã9%ulApXDPt Јt&`X©  2pXDpt `XCp(t (?uozDž$(jh*h* Sjh*h*4h*ӇDžPh*豇‰װэA=vRh*5hXpjh*iƃtjj jVDj葇ƃRh+V* hh*h G؊hh*Ph G PthVh Gފhh*h GĊjh*h G(9tC This document was created by man2html, using the manual pages.
Time: %s /usr/newsprint/man//usr/ncd/man//usr/sunpc/man//usr/titools/man//usr/motif/man//usr/gnu/man//usr/lang/man//usr/www/man//usr/tex/man//usr/openwin/man//usr/exp/man//usr/local/man//usr/man//usr/X11/man//.gz/bin/gzip -d -c.Z/bin/zcat123456789nlman2html: out of memoryman2html: escape_input - str too long: %-80s... man2html: pipe_open - str too long: %-80s... r/usr/share/doc/man2html/html/man.htmlman2html: error openning %s: %m Content-type: text/html Manual Pages

Manual Pages

This is a HyperText interface to the UNIX manpages. You can enter a program name, the section, an extra directory (using -M) or a full name. For example
  • elm
  • elm 1
  • -M /usr/local/man elm
  • /local/gcc/man/man1/gperf.1

This man2html converter was written by Richard Verhoeven man2html: error reading %s: %m ''``®[]§_¯}_|¯|¬×{|_|¯`flfiffØ=----÷+°¢©|~´fflffi¾¼½±zetaetachiomegaupsilontausigmarhopsipionuµlambdakappaiotathetagammaphiepsilondeltaxibetaalphaZHXOmegaYTSigmaPPsiPiONMLambdaKIThetaGammaPhiEDeltaXiBA*%T GMT, %B %d, %Y<.gz.Z.z://www.ftp..h>%s>%s%sftphttp%s%s%s11 


 0@Xman2html: unknown operator %c.
ǵxǵǵǵǵǵǵǵǵǵǵǵǵǵǵǵǵǵǵǵǵǵǵǵǵǵǵǵǵǵǵǵǵrE 0Ӷ`pThe C Programming LanguageKRSPARC Architecture ManualSARCHSun-4 Assembly Language Reference4ASSYSunCore Reference ManualCORESunCGI Reference ManualCGIPixrect Reference ManualPIXRCTSunView 1 System Programmer's GuideSVSPGSunView 1 Programmer's GuideSVPGFloating-Point Programmer's GuideFPOINTWriting Device Drivers for the SBusWDDSSBus Developer's KitSBDKSTREAMS ProgrammingSTREAMSWriting Device DriversDRIVERNetwork ProgrammingNETPDebugging ToolsDEBUGProgramming Utilities and LibrariesPULAssembly Language ReferenceASSYC Reference ManualCREFC Programmer's GuideCPGGlobal IndexINDEXUsing nroff and troffTROFFFormatting DocumentsDOCSEditing Text FilesTEXTSystem Services OverviewSSOSun System IntroductionSSIREFMANSunOS Reference ManualMANPAGESSundiag User's GuideSUNDIAGSun System DiagnosticsDIAGPROM User's ManualPROMSecurity Features GuideSECURSystem and Network AdministrationADMINInstalling SunOS 4.1INSTALLSunOS 4.1 Release ManualCHANGEGames, Demos & Other PursuitsGDBGUsing the NetworkUNBGDoing More with SunOSDMBGMail and MessagesMMBGSunView User's GuideSVBGBasic TroubleshootingSHBGCustomizing SunOSSUBGGetting Started GSBGMisc. Reference Manual PagesLocal CommandsL8V8S8CMaintenance Commands87VEnvironments, Tables, and Troff Macros7Games and Demos65VFile Formats54V4SProtocols4P4N4M4IProtocol Families4FDevices and Network Interfaces4Miscellaneous Library Functions3X3VStandard I/O Functions3SRPC Services Library3RNetwork Functions3NMathematical Library3MLightweight Processes Library3LKernel VM Library Functions3KFortran Library Routines3FCompatibility Functions3CC Library Functions32VSystem Calls21V1S1GUser Commands1CUser Commands 1



%s

.di
.. 
man2html: unable to open or read file %s.

man2html: unable to open or read file.


[ ]






"> 

"> 

SYNOPSIS



Manpage of �




Section:  ()
Updated: )
Index

Return to Main Contents



BSD mandoc
..-bullet
    
-enum
      



Xo
  •  is currently in beta test.BSD 
    -offset indent
    
-literal-unfilled]('file ... - `man2html: search_manpath_all - name too long: 
%-80s...
manman2html: search_manpath_section - name too long: 
%-80s...
man2html: search_manpath - name too long: 
%-80s...
/etc/manpath.config 	MANDATORY_MANPATH 	
man2html: invalid -M path: %s
PATH_INFOhttp:http:/cgi-bin/man2htmlhttp://SERVER_NAMEman2html: error - server name is too long: 
%-80s...
SERVER_PORT:%dman2html: error - name too long: man%c/%-80s.%-80s
man%c/%s.%sLocation: %s%s

Location: %s%sman%c/%s

 for section Content-type: text/html



Index to %s manpages.


    Index to %s manpages%s%c
    
Sorry, no manpages available for %s.

  • %s (%s)

Content-type: text/html
man2html: request for non man file %s
Status: 403 Forbidden


Manpage: Error


    Only manpages are allowed.
    
To view the file you wanted, use this
link instead

Status: 403 Forbidden


Manpage: Error


    Only manpages are allowed
    
To view the file you wanted, use this
link instead

/../man2html: attempt to use .. in man2html: %s
Status: 403 Forbidden


Manpage: Error


    Warning.
    
You still try to get files which are manpages. Using the
.. construction to get to a different directory will
not work either. If you try this very often, you
will end up in a black list.

 in section Status: 404 Not Found


No manpage for %s.


    No manpage for %s.
    
Sorry, the manpage for %s does not exist%s%s, nor in any other section.
in any section.

    
The links to other manual pages are not always correct.
Normally you will get a list of possible replacements,
but in this case the manual page just can't be found.
one of the following pagesthis page.
Maybe you can use %s instead.

      
Status: 500 Internal Server Error


No manpage for %s.


      No manpage for %s.
      
Sorry, unable to convert the manpage for %s.


      
 
      Index
      

      


Status: 403 Forbidden


Invalid Manpage

      Invalid Manpage
      
You tried to retrieve an incorrect manpage.
The page does not contain a manpage header and will
not produce any output.
If the page is a formatted manpage, you might want to use
a different man2html (or cat2html) converter.
You can also try to load the
plain file
W@
~tdVD6(





ixAAA n t o el.F$.A.T.V. RFqlCqr@**A*B*C*D*E*F*G*H*I*K*L*M*N*O*P*Q*R*S*T*U*W*X*Y*Z*a*b*c*d*e*{f*wg*qh*ki*fk*`l*Ym*Rn*Oo*Mp*Jq*Fr*Bs*<t*8u*0w**x*&y*"z*st<-+214143iFlFaaparbubvbicMoctcedgdidmemeqeseffiflfmfagyhclflklimumonrolpcr|frygrFkr`nrYurWcsPlsqsMluW\'. (08@HPX`|wofaYPJA8	\fR\s0-"""""!!!!!!!!!!`!>!%!!!!      y q \ S < 5 < 1   zva\ID($~id@"{b^FA("$$$$$$$$$$$u$r$u$p$\$Y$A$>$%$"$$$##########\$#`#?# ##	## ## ## #""" #" #""""""""""~"i"f"i"c"i"`"i"^"O"2"lbAAW‰҉"2BRbrŠҊ"2BRbr‹ҋX
(
W@0oooX.symtab.strtab.shstrtab.interp.note.ABI-tag.hash.dynsym.dynstr.gnu.version.gnu.version_r.rel.got.rel.bss.rel.plt.init.plt.text.fini.rodata.data.eh_frame.ctors.dtors.got.dynamic.bss# 1((\7?GoXX`To0c	l	(u	@~XX	1	  ܀ 
 ) G VWWWW`X`T[ `